Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319254.1 | 3prime_partial | 139 | 417-1(-) |
Amino Acid sequence : | |||
MASLISSWAAQVNSVPERYVVPSEKRFNINVPIGKDIPVIDLSLPSQNIVAEIIKASQEYGVFQVINHGVSKELIADVLKVCGEFFKLPIEELEKYTEEEELSEFEPNLDQKPKLFIEKE YKPKKNDKEVFSGKIHLPI | |||
Physicochemical properties | |||
Number of amino acids: | 139 | ||
Molecular weight: | 14,416.695 | ||
Theoretical pI: | 10.159 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 27960 | ||
Instability index: | 40.216 | ||
aromaticity | 0.216 | ||
GRAVY | 0.107 | ||
Secondary Structure Fraction | |||
Helix | 0.500 | ||
turn | 0.198 | ||
sheet | 0.207 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319254.1 | 5prime_partial | 116 | 1-351(+) |
Amino Acid sequence : | |||
NGQMYLSRKYFLIILLRFIFFFNEKLWFLVQIWLKFTQLFFFSILLQFLNWQLEKLPTNFQNISNQLFRHSMVNHLKDSILLRSFDDFSNYILRRQRQVNNWNVFANGDIYIKSFL* | |||
Physicochemical properties | |||
Number of amino acids: | 116 | ||
Molecular weight: | 14,416.695 | ||
Theoretical pI: | 10.159 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 27960 | ||
Instability index: | 40.216 | ||
aromaticity | 0.216 | ||
GRAVY | 0.107 | ||
Secondary Structure Fraction | |||
Helix | 0.500 | ||
turn | 0.198 | ||
sheet | 0.207 |