Acc_NO	ORF type	length	start-end position (strand +/-)
>GW319269.1	internal	142	427-2(-)
Amino Acid sequence :
SSAITFSDEDPLIRQVVSETKDNHVLNAEHHFSLFKSKYGKIYATQEEHDQRFNVFKANLRRARRHQMLDPTAEHGITKFSDLTPSEFRRTYLGLHKPKPKFNAEKAPILPTSDLPADFD WREKGAVTGVKNQGSCGSCWSF
Physicochemical properties
Number of amino acids:		142
Molecular weight:		16,250.035
Theoretical pI:		8.906
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		15470 15595
Instability index:		40.708
aromaticity		0.106
GRAVY		-0.773
Secondary Structure Fraction
Helix		0.254
turn		0.232
sheet		0.211