Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319293.1 | internal | 144 | 434-3(-) |
Amino Acid sequence : | |||
VKGKLIASVEVKCGGHSIHDIFHMNTHHITKISPNKVQHFEVHEGETIKVGSIVGWKYSDDGKDKTCKQVIEAVDLEKKSITWKVIGGDLLELYNSFTIITSCDDHWTTWTLLYEKKTED TPEPLVFLGYALHVTKEVEDHLVK | |||
Physicochemical properties | |||
Number of amino acids: | 144 | ||
Molecular weight: | 16,370.518 | ||
Theoretical pI: | 6.042 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28085 | ||
Instability index: | 18.815 | ||
aromaticity | 0.083 | ||
GRAVY | -0.315 | ||
Secondary Structure Fraction | |||
Helix | 0.340 | ||
turn | 0.167 | ||
sheet | 0.188 |