Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319294.1 | internal | 196 | 588-1(-) |
Amino Acid sequence : | |||
RSDIIFAAKVGVNLTTYDSEDEVYKIRKHHPKSELLLRIKPMDDANARCPMGPKYGALPEEVEPLLQAAHAARLTVSGVSFHIGSGDADSNAYLGAIAAAKEVFQTAAKFGMSKMTILDI GGGFTSGHQFTTAATAVKSALSQHFHDETELTIIAEPGRFFAETAFTLATTIIGKRVRGELREYWINDGLYGSMNC | |||
Physicochemical properties | |||
Number of amino acids: | 196 | ||
Molecular weight: | 21,253.900 | ||
Theoretical pI: | 6.174 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
Instability index: | 31.287 | ||
aromaticity | 0.087 | ||
GRAVY | -0.121 | ||
Secondary Structure Fraction | |||
Helix | 0.276 | ||
turn | 0.209 | ||
sheet | 0.296 |