Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319302.1 | 3prime_partial | 110 | 30-359(+) |
Amino Acid sequence : | |||
MDSGDNEVTIDLSPLLRVFKDGHVERMFGSPIVPPSLEDPTTGVASKDIDISPDIRARVYLPKLTNTTNEKLPILVYYHGGGFCLESAFSFLDHRYLNLIVSEAKVIAIS | |||
Physicochemical properties | |||
Number of amino acids: | 110 | ||
Molecular weight: | 12,149.756 | ||
Theoretical pI: | 4.993 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 5960 | ||
Instability index: | 33.433 | ||
aromaticity | 0.082 | ||
GRAVY | 0.019 | ||
Secondary Structure Fraction | |||
Helix | 0.355 | ||
turn | 0.264 | ||
sheet | 0.227 |