Acc_NO	ORF type	length	start-end position (strand +/-)
>GW319333.1	internal	144	434-3(-)
Amino Acid sequence :
SFMLQHVVPLPIIGALYCVLFAFMSAAGFDLLQFCNLNSYRTKFILGFSIYMGLSVPQYFNGYVITTGRGPVQSGSATFDQIMQVIFTSHATVAGIIAYFLDITLARSDPFTRKDSGRHW WAKFKYFGRDPRSEEFYSLPYGLS
Physicochemical properties
Number of amino acids:		144
Molecular weight:		16,286.623
Theoretical pI:		8.950
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		24410 24535
Instability index:		40.342
aromaticity		0.181
GRAVY		0.270
Secondary Structure Fraction
Helix		0.396
turn		0.243
sheet		0.201