Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319334.1 | internal | 111 | 335-3(-) |
Amino Acid sequence : | |||
PRPTLTAYYHDDADAGVEQQKVSFVKDLKPRPTITAYDHDDAGLEQEKSSISKDFKPRLTITAYYLDEASLKQEKSPFAKNIKPRDSATSYRHNEDHLKEGKSFEPRPNVS | |||
Physicochemical properties | |||
Number of amino acids: | 111 | ||
Molecular weight: | 12,667.836 | ||
Theoretical pI: | 6.510 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 8940 | ||
Instability index: | 37.246 | ||
aromaticity | 0.090 | ||
GRAVY | -1.127 | ||
Secondary Structure Fraction | |||
Helix | 0.225 | ||
turn | 0.225 | ||
sheet | 0.216 |