Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319344.1 | 5prime_partial | 130 | 418-26(-) |
Amino Acid sequence : | |||
ENVLSNEPAVVKRGQHIVEVKPQGVTKGLVAQKVLSMMVNSGKPPDFVMCIGDDRSDEDMFESILSSVSSPSVTAAPDIFACTVGQKPSKAKYYLDDTADVLRLLRGLTNASCPKPRHTA HSQVAFDSVL* | |||
Physicochemical properties | |||
Number of amino acids: | 130 | ||
Molecular weight: | 13,986.850 | ||
Theoretical pI: | 6.328 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 42.992 | ||
aromaticity | 0.046 | ||
GRAVY | -0.145 | ||
Secondary Structure Fraction | |||
Helix | 0.277 | ||
turn | 0.262 | ||
sheet | 0.223 |