Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319346.1 | 5prime_partial | 132 | 423-25(-) |
Amino Acid sequence : | |||
YTWKQVFLLVDIVCCCAVLFPIVWSIKNLREAAKTDGKAAVNLMKLTLFRQYYVIVICYIYFTRVVVYALETITSYRYQWTSVVAAEAATLAFYVFTGYNFRPKAHNPYFAVDDEEEEAA SEALKLEDEFEL* | |||
Physicochemical properties | |||
Number of amino acids: | 132 | ||
Molecular weight: | 15,329.543 | ||
Theoretical pI: | 4.975 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 32890 33140 | ||
Instability index: | 17.676 | ||
aromaticity | 0.174 | ||
GRAVY | 0.306 | ||
Secondary Structure Fraction | |||
Helix | 0.432 | ||
turn | 0.098 | ||
sheet | 0.303 |