Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319352.1 | 5prime_partial | 187 | 574-11(-) |
Amino Acid sequence : | |||
EEDLFTSKSPLLLKMNPVHKQIPVLVHNGKPVCESLVAVEYIDEVWKDKAPLLSSDPYERAQARFWAAYTDKLYDFGRRIWTATREEFGEGKKDLIDPLKLLEESALGDKPYFGGESLGF VDIALLGFSSWFYTYETFGNFSIEAECPKVAAWAKRCMQRESVSKSLADPNKICEKLLEFRKKSGLE* | |||
Physicochemical properties | |||
Number of amino acids: | 187 | ||
Molecular weight: | 21,355.179 | ||
Theoretical pI: | 5.424 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37930 38180 | ||
Instability index: | 36.650 | ||
aromaticity | 0.123 | ||
GRAVY | -0.366 | ||
Secondary Structure Fraction | |||
Helix | 0.326 | ||
turn | 0.209 | ||
sheet | 0.299 |