Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319362.1 | internal | 191 | 2-574(+) |
Amino Acid sequence : | |||
KKHQELRKMENLLTDAQREEVVTTFCDITSSSKPEALFFLESHNFDLDSAVSTFFENNTLPPDDDVPAPNIAAQRSSPSPPRPTNPPSSSHGGAAGRRTGGIHTFSDMNRQTVTGPGSDS DEPQEYYTGGEKSGMLVQDPTKANDRDAIFDQARQHAAVEGPPASSGSRSFTGTSRTLMDETVFVAPQPPE | |||
Physicochemical properties | |||
Number of amino acids: | 191 | ||
Molecular weight: | 12,183.271 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18115 | ||
Instability index: | 68.661 | ||
aromaticity | 0.055 | ||
GRAVY | -0.036 | ||
Secondary Structure Fraction | |||
Helix | 0.321 | ||
turn | 0.312 | ||
sheet | 0.193 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319362.1 | complete | 109 | 469-140(-) |
Amino Acid sequence : | |||
MLSSLIKYRIPVICFSWILNKHSTFLSAGIILLRLIGVTPRPSNSLTIHIRKGMNSTSSPPSSAAMARARRVCRSRWRRRRALSGDVRGRNIVVWGEGIVLKESGNGRI* | |||
Physicochemical properties | |||
Number of amino acids: | 109 | ||
Molecular weight: | 12,183.271 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18115 | ||
Instability index: | 68.661 | ||
aromaticity | 0.055 | ||
GRAVY | -0.036 | ||
Secondary Structure Fraction | |||
Helix | 0.321 | ||
turn | 0.312 | ||
sheet | 0.193 |