Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319364.1 | internal | 169 | 507-1(-) |
Amino Acid sequence : | |||
PVYDALAPGPSLAPAPAPGPGGPHHHFDGESQVKDFIQTLLHYGGYNELADILVNLTSLATEMGKLVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIMYYHLIPEYQTEESMYNSVR RFGKVKYDTLRLPHKVVAEEADGSVKFGSGEEGSAYLFDPDIYTDGRIS | |||
Physicochemical properties | |||
Number of amino acids: | 169 | ||
Molecular weight: | 18,417.347 | ||
Theoretical pI: | 4.605 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16390 16390 | ||
Instability index: | 49.571 | ||
aromaticity | 0.095 | ||
GRAVY | -0.338 | ||
Secondary Structure Fraction | |||
Helix | 0.296 | ||
turn | 0.266 | ||
sheet | 0.290 |