Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319374.1 | internal | 108 | 324-1(-) |
Amino Acid sequence : | |||
LEKFLGRIPMVFNVVILSPHGYFAQENVLGYPDTGGQVVYILDQVPALEREMLKRIKEQGLDITPRILIVTRLLPDAVGTTCGQRLEKVYGTENSHILRVPFRTEKGI | |||
Physicochemical properties | |||
Number of amino acids: | 108 | ||
Molecular weight: | 12,191.123 | ||
Theoretical pI: | 8.092 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 5960 | ||
Instability index: | 29.106 | ||
aromaticity | 0.074 | ||
GRAVY | 0.002 | ||
Secondary Structure Fraction | |||
Helix | 0.380 | ||
turn | 0.204 | ||
sheet | 0.241 |