Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319378.1 | internal | 188 | 566-3(-) |
Amino Acid sequence : | |||
EMRSYKEAVLNPAKQMREDNQLLVWFKNKAAKHQMQAKALEESLSLVSEKHRQTLEENKIVRSKAKLHHEQIKEEMEFQEQFFKDQIKIIHDARTAEEDKFEKKQQEQREMVKQSSANTS SVEDHRVRAEKVARFIKLQDKEMEEFVVERESLMRSHEDRIVALRRKYWEEEVELEKKFDLELAKLMD | |||
Physicochemical properties | |||
Number of amino acids: | 188 | ||
Molecular weight: | 15,916.966 | ||
Theoretical pI: | 8.655 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6210 | ||
Instability index: | 27.346 | ||
aromaticity | 0.172 | ||
GRAVY | 0.719 | ||
Secondary Structure Fraction | |||
Helix | 0.500 | ||
turn | 0.164 | ||
sheet | 0.299 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319378.1 | complete | 134 | 96-500(+) |
Amino Acid sequence : | |||
MTSHQTLPLYNKLFHFLVLKFDKSCNFFCPDSMILNRGSICTRLFDHLTLLLLFLFKLVLLSSPGIMNYLDLILEKLFLKFHLFLDLFMVQLCFRSYNLVLFQCLTVLFTHQTERLFKSF SLHLVFSGFVLEPY* | |||
Physicochemical properties | |||
Number of amino acids: | 134 | ||
Molecular weight: | 15,916.966 | ||
Theoretical pI: | 8.655 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6210 | ||
Instability index: | 27.346 | ||
aromaticity | 0.172 | ||
GRAVY | 0.719 | ||
Secondary Structure Fraction | |||
Helix | 0.500 | ||
turn | 0.164 | ||
sheet | 0.299 |