Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319386.1 | internal | 144 | 433-2(-) |
Amino Acid sequence : | |||
EGVTLDGAIQHTENGGFPYTEMIVHLPLGSIPSPKKVLIIGGGIGFTLFEVSRYSTIEKIDIVEIDDVVIDVSRKYFPYLAAGFDDPRVTLIVGDGAAFVKAAQPGYYDAIIVDSSDPIG PAKDLFERPFFEAVAKTLRPGGVV | |||
Physicochemical properties | |||
Number of amino acids: | 144 | ||
Molecular weight: | 15,472.510 | ||
Theoretical pI: | 4.595 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 8940 | ||
Instability index: | 33.244 | ||
aromaticity | 0.104 | ||
GRAVY | 0.226 | ||
Secondary Structure Fraction | |||
Helix | 0.375 | ||
turn | 0.243 | ||
sheet | 0.201 |