Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319388.1 | internal | 136 | 410-3(-) |
Amino Acid sequence : | |||
FANIRIVNKLLNGEVGPKTIHIPTGEKLSVFDSAMKYKSAGQDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDAETLGLTGHERFTIDIPDK ISEIRPGQDITVPARA | |||
Physicochemical properties | |||
Number of amino acids: | 136 | ||
Molecular weight: | 14,560.647 | ||
Theoretical pI: | 8.777 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 25.925 | ||
aromaticity | 0.059 | ||
GRAVY | -0.046 | ||
Secondary Structure Fraction | |||
Helix | 0.294 | ||
turn | 0.257 | ||
sheet | 0.250 |