Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319389.1 | internal | 107 | 322-2(-) |
Amino Acid sequence : | |||
LTVPADVPSVAQDCEQLRSAFKGWGTNEKLIISILGHRSAAQRKLIRETCAETYGEDLLKELDRELTNDFEKLVVVWSLDPAERDAHLAKEATKRWTKSNFVLVEIA | |||
Physicochemical properties | |||
Number of amino acids: | 107 | ||
Molecular weight: | 12,094.627 | ||
Theoretical pI: | 5.399 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18115 | ||
Instability index: | 30.225 | ||
aromaticity | 0.065 | ||
GRAVY | -0.322 | ||
Secondary Structure Fraction | |||
Helix | 0.308 | ||
turn | 0.150 | ||
sheet | 0.327 |