Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319391.1 | 5prime_partial | 132 | 452-54(-) |
Amino Acid sequence : | |||
GGSRQYRNLFDAMLDSVYAAMDRSGGGSVGIVVSESGWPSAGAFGATTDNAATYLRNLIQHVKVGSPRKPGPIETYIFAMFDENNKNPELEKHFGLFSPNKQPKYNLNFGVSDNAWDISA ETNATTSPISEM* | |||
Physicochemical properties | |||
Number of amino acids: | 132 | ||
Molecular weight: | 14,310.690 | ||
Theoretical pI: | 5.271 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18450 | ||
Instability index: | 43.530 | ||
aromaticity | 0.106 | ||
GRAVY | -0.455 | ||
Secondary Structure Fraction | |||
Helix | 0.258 | ||
turn | 0.341 | ||
sheet | 0.227 |