Acc_NO	ORF type	length	start-end position (strand +/-)
>GW319407.1	internal	113	341-3(-)
Amino Acid sequence :
FSMTGGVSKEEEMNVTLHLLKKKMDDFAKERDWEKFHSPRNLLLALVGEVGELSEIFQWKGEVPKGLPDWQENEKLHLGEELSDVLLYLVRLSHICGIDLGQAALRKLQLNAI
Physicochemical properties
Number of amino acids:		113
Molecular weight:		12,912.769
Theoretical pI:		5.348
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		17990 17990
Instability index:		32.085
aromaticity		0.071
GRAVY		-0.275
Secondary Structure Fraction
Helix		0.345
turn		0.195
sheet		0.363