Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319408.1 | internal | 165 | 496-2(-) |
Amino Acid sequence : | |||
WPEKPPQYREVIGKYTEGVRKASLTIMELMCEGLGLEKDHFANHQLSHIQYMAINLYPKCPDPNVTAGAVEHNDGGVINLILQELGGLHVRRHKDGQWFAVEPIPGALACINGMILKVIS NGKLESGIHRVATNSVSDRISLGCLTSPACSGECIIEPAKALLSE | |||
Physicochemical properties | |||
Number of amino acids: | 165 | ||
Molecular weight: | 17,951.538 | ||
Theoretical pI: | 6.172 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17335 | ||
Instability index: | 46.295 | ||
aromaticity | 0.048 | ||
GRAVY | -0.088 | ||
Secondary Structure Fraction | |||
Helix | 0.297 | ||
turn | 0.267 | ||
sheet | 0.279 |