Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319409.1 | internal | 162 | 487-2(-) |
Amino Acid sequence : | |||
QGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIVHLPLGSIPSPKKVLIIGGGIGFTLFEVSRYSTIEKIDIVEIDDVVIDVSRKYFPYLAAGFDDPRVTLIVGDGAAFVKA AQPGYYDAIIVDSSDPIGPAKDLFERPFFEAVAKTLRPGGVV | |||
Physicochemical properties | |||
Number of amino acids: | 162 | ||
Molecular weight: | 17,548.838 | ||
Theoretical pI: | 4.639 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11920 11920 | ||
Instability index: | 31.467 | ||
aromaticity | 0.111 | ||
GRAVY | 0.147 | ||
Secondary Structure Fraction | |||
Helix | 0.370 | ||
turn | 0.235 | ||
sheet | 0.204 |