Acc_NO	ORF type	length	start-end position (strand +/-)
>GW319410.1	internal	103	309-1(-)
Amino Acid sequence :
RINSWPEKPPQYREVIGKYTEGVRKASLTIMELMCEGLGLEKDHFANHQLSHIQYMAINLYPKCPDPNVTAGAVEHNDGGVINLILQELGGLHVRRHKDGQWF
Physicochemical properties
Number of amino acids:		103
Molecular weight:		11,720.273
Theoretical pI:		6.642
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		16960 17085
Instability index:		41.722
aromaticity		0.078
GRAVY		-0.492
Secondary Structure Fraction
Helix		0.301
turn		0.243
sheet		0.252