Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319423.1 | 5prime_partial | 152 | 3-461(+) |
Amino Acid sequence : | |||
YIKEENMGVKGKLIASVEVKCGGHSIHGIFHMNTHHITKISPNKVQHFEVHEGETVKVGSIVGWKYSDDGKEKTCKQVIEAVDLEKKSITWKVVGGDLLELYNSFTIITSCDDHWTTWTL VYEKKTEDTPEPLVFLGYALHVTKEVEDHLVK* | |||
Physicochemical properties | |||
Number of amino acids: | 152 | ||
Molecular weight: | 17,249.510 | ||
Theoretical pI: | 6.051 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29450 29575 | ||
Instability index: | 18.569 | ||
aromaticity | 0.086 | ||
GRAVY | -0.343 | ||
Secondary Structure Fraction | |||
Helix | 0.336 | ||
turn | 0.178 | ||
sheet | 0.197 |