Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319433.1 | internal | 143 | 1-429(+) |
Amino Acid sequence : | |||
KGKLIASVEVKCGGHSIHDIFHMNTHHITKISPNKVQHFEVHEGETIKVGSIVGWKYSDDGKDKTCKQVIEAVDLEKKSITWKVIGGDLLELYNSFTIITSCDDHWTTWTLLYEKKTEDT PEPLVFLGYALHVTKEVEDHLVK | |||
Physicochemical properties | |||
Number of amino acids: | 143 | ||
Molecular weight: | 16,271.387 | ||
Theoretical pI: | 6.043 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28085 | ||
Instability index: | 19.078 | ||
aromaticity | 0.084 | ||
GRAVY | -0.346 | ||
Secondary Structure Fraction | |||
Helix | 0.336 | ||
turn | 0.168 | ||
sheet | 0.189 |