Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319435.1 | internal | 144 | 432-1(-) |
Amino Acid sequence : | |||
TGRRDGRISNASEALANIPPPTSNFSSLQTSFASKGLDLKDLVLLSGAHTIGVSHCPSFSSRLYNFTGVWGKQDPSLDGEYAANLKMKKCKSINDNTTIVEMDPGSASKFDLGYYKLVLK RRGLFQSDAALTTSATTKSYINHL | |||
Physicochemical properties | |||
Number of amino acids: | 144 | ||
Molecular weight: | 15,594.422 | ||
Theoretical pI: | 9.300 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
Instability index: | 36.847 | ||
aromaticity | 0.083 | ||
GRAVY | -0.348 | ||
Secondary Structure Fraction | |||
Helix | 0.271 | ||
turn | 0.306 | ||
sheet | 0.222 |