Acc_NO	ORF type	length	start-end position (strand +/-)
>GW319435.1	internal	144	432-1(-)
Amino Acid sequence :
TGRRDGRISNASEALANIPPPTSNFSSLQTSFASKGLDLKDLVLLSGAHTIGVSHCPSFSSRLYNFTGVWGKQDPSLDGEYAANLKMKKCKSINDNTTIVEMDPGSASKFDLGYYKLVLK RRGLFQSDAALTTSATTKSYINHL
Physicochemical properties
Number of amino acids:		144
Molecular weight:		15,594.422
Theoretical pI:		9.300
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12950 13075
Instability index:		36.847
aromaticity		0.083
GRAVY		-0.348
Secondary Structure Fraction
Helix		0.271
turn		0.306
sheet		0.222