Acc_NO	ORF type	length	start-end position (strand +/-)
>GW319437.1	internal	149	449-3(-)
Amino Acid sequence :
GDNMGLKGKLIASVEVKCGGHSIHDIFHMNTHHITKISPNKVQHFEVHEGETIKVGSIVGWKYSDDGKDKTCKQVIEAVDLEKKSITWKVIGGDLLELYNSFTIITSCDDHWTTWTLLYE KKTEDTPEPLVFLGYALHVTKEVEDHLVK
Physicochemical properties
Number of amino acids:		149
Molecular weight:		16,859.033
Theoretical pI:		5.900
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		27960 28085
Instability index:		18.142
aromaticity		0.081
GRAVY		-0.346
Secondary Structure Fraction
Helix		0.329
turn		0.181
sheet		0.195