Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319438.1 | 5prime_partial | 120 | 384-22(-) |
Amino Acid sequence : | |||
VGLCINLFFTFPLMMNPVYEVVERRFCDGRYCVWLRWIVVLAVTFVALLVPNFADFLSLVGSSVCIILGFVLPALFHLIVFKDELKWYGLACDGAIILMAAVLSLYGTYSSMLEIFGEKA * | |||
Physicochemical properties | |||
Number of amino acids: | 120 | ||
Molecular weight: | 13,499.116 | ||
Theoretical pI: | 5.156 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24200 | ||
Instability index: | 33.566 | ||
aromaticity | 0.158 | ||
GRAVY | 1.148 | ||
Secondary Structure Fraction | |||
Helix | 0.508 | ||
turn | 0.175 | ||
sheet | 0.308 |