Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319440.1 | internal | 145 | 437-3(-) |
Amino Acid sequence : | |||
AAGNYPEWKLFIQIMDTEDVDKFDFDPLDVTKIWPEDIFPLMPVGRLVLNRNIDNFFAENEQLAFNPGHIVPGIYYSEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCAHHNNHRDG AMNFMHRDEEVDYLPSRFDPCRPAE | |||
Physicochemical properties | |||
Number of amino acids: | 145 | ||
Molecular weight: | 16,979.937 | ||
Theoretical pI: | 5.022 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
Instability index: | 48.032 | ||
aromaticity | 0.124 | ||
GRAVY | -0.583 | ||
Secondary Structure Fraction | |||
Helix | 0.303 | ||
turn | 0.221 | ||
sheet | 0.234 |