Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319446.1 | internal | 177 | 532-2(-) |
Amino Acid sequence : | |||
CAHPTKEDRINSWPEKPPQYREVIGKYTEGVRKASLTIMELMCEGLGLEKDHFANHQLSHIQYMAINLYPKCPDPNVTAGAVEHNDGGVINLILQELGGLHVRRHKDGQWFAVEPIPGAL VCINGMILKVISNGKLESGIHRVATNSVSDRISLGCLTSPACSGECIIEPAKALLSE | |||
Physicochemical properties | |||
Number of amino acids: | 177 | ||
Molecular weight: | 19,332.068 | ||
Theoretical pI: | 6.253 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17335 | ||
Instability index: | 41.372 | ||
aromaticity | 0.045 | ||
GRAVY | -0.161 | ||
Secondary Structure Fraction | |||
Helix | 0.288 | ||
turn | 0.266 | ||
sheet | 0.266 |