Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319448.1 | 5prime_partial | 126 | 434-54(-) |
Amino Acid sequence : | |||
RNLFDAMLDSVYAAMDRSGGGSVGIVVSESGWPSAGAFGATTDNAATYLRNLIQHVKVGSPRKPGPIETYIFAMFDENNKNPELEKHFGLFSPNKQPKYNLNFGVSDNAWDISAETNATT SLISEM* | |||
Physicochemical properties | |||
Number of amino acids: | 126 | ||
Molecular weight: | 13,678.064 | ||
Theoretical pI: | 5.019 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
Instability index: | 39.543 | ||
aromaticity | 0.103 | ||
GRAVY | -0.348 | ||
Secondary Structure Fraction | |||
Helix | 0.270 | ||
turn | 0.325 | ||
sheet | 0.246 |