Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319450.1 | 5prime_partial | 115 | 3-350(+) |
Amino Acid sequence : | |||
LSIFWQIPQYFILGAAEIFTFIGQLEFFYDQSPDAMRSLCSALSLMTTALGNYLSSFILTIVTSITTRGGKPGWIPNNLNSGHLDYFFWLLAALSFSNLVIYIFCAKMYKSKKAS* | |||
Physicochemical properties | |||
Number of amino acids: | 115 | ||
Molecular weight: | 12,958.975 | ||
Theoretical pI: | 8.641 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25565 | ||
Instability index: | 36.026 | ||
aromaticity | 0.174 | ||
GRAVY | 0.495 | ||
Secondary Structure Fraction | |||
Helix | 0.417 | ||
turn | 0.252 | ||
sheet | 0.252 |