Acc_NO	ORF type	length	start-end position (strand +/-)
>GW319451.1	internal	100	301-2(-)
Amino Acid sequence :
LVDWARPKLNDKRKMLQIIDPRLDNQYSVRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQSNGGSANETLSTGTSVRFAIGRVPDYRTHHRYGSSL
Physicochemical properties
Number of amino acids:		100
Molecular weight:		11,237.635
Theoretical pI:		9.512
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12950 13075
Instability index:		37.569
aromaticity		0.070
GRAVY		-0.569
Secondary Structure Fraction
Helix		0.270
turn		0.260
sheet		0.240