Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319451.1 | internal | 100 | 301-2(-) |
Amino Acid sequence : | |||
LVDWARPKLNDKRKMLQIIDPRLDNQYSVRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPLQSNGGSANETLSTGTSVRFAIGRVPDYRTHHRYGSSL | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 11,237.635 | ||
Theoretical pI: | 9.512 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
Instability index: | 37.569 | ||
aromaticity | 0.070 | ||
GRAVY | -0.569 | ||
Secondary Structure Fraction | |||
Helix | 0.270 | ||
turn | 0.260 | ||
sheet | 0.240 |