Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319459.1 | 5prime_partial | 181 | 553-8(-) |
Amino Acid sequence : | |||
QLSTANITQRITIPYSGAFAVIQHRLKQIYESVESSTDEESGVPTLRVHERVTVKQESENHLSLHWPADPISDMVSDSIVALVLNASREMPKVSIESESLMNEEEDVKKAEKIVHALLIS LFGDVKFGDNGKLVINVDGNVAHLDKQTGDVECENEGLKERVRTAYRRIRSAVKPIPLSTF* | |||
Physicochemical properties | |||
Number of amino acids: | 181 | ||
Molecular weight: | 20,177.583 | ||
Theoretical pI: | 5.400 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
Instability index: | 40.282 | ||
aromaticity | 0.044 | ||
GRAVY | -0.329 | ||
Secondary Structure Fraction | |||
Helix | 0.304 | ||
turn | 0.227 | ||
sheet | 0.260 |