Acc_NO	ORF type	length	start-end position (strand +/-)
>GW319460.1	internal	163	490-2(-)
Amino Acid sequence :
LRSFFVFLLALVTYTYAATIEVRNNCPYTVWAASTPIGGGRRLNRGQTWVINAPRGTKMARIWGRTGCNFNAAGRGSRQTGDCGGVLKCTGWGKPPNTLAEYALDQFSNLDFWDISLVDG FNIPMTFAPTKPSGGKCHAIHCTANINGECPRALKVPGGCNNP
Physicochemical properties
Number of amino acids:		163
Molecular weight:		17,614.961
Theoretical pI:		9.434
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		33460 33960
Instability index:		38.079
aromaticity		0.104
GRAVY		-0.175
Secondary Structure Fraction
Helix		0.270
turn		0.307
sheet		0.190