Acc_NO	ORF type	length	start-end position (strand +/-)
>GW319467.1	internal	184	552-1(-)
Amino Acid sequence :
IREGGVRTTLRRALRFYSTLQADDGHWPADYGGPLFLLPGLVISLFIMGAVNVVLSEEHQKEILRYLYNHQNRDGGWGLHIEGHSIMFCAALNYVTLRLLGEEVNNEGMEKARKWILEHG GLTYIPSWGKFWLSALGVYEWSGNNPLPPELWLLPYFVPIHPGRMWCHCRMVYLPMSYLYGTRY
Physicochemical properties
Number of amino acids:		184
Molecular weight:		21,269.363
Theoretical pI:		7.243
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		61880 62005
Instability index:		42.452
aromaticity		0.141
GRAVY		-0.094
Secondary Structure Fraction
Helix		0.386
turn		0.255
sheet		0.283