Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319474.1 | internal | 162 | 487-2(-) |
Amino Acid sequence : | |||
QNPPQYREVIGKYTEGVRKASLRIMELMCEGLGLEKDHFANELSHIQYMAINLYPKCPDPNVTAGAVEHNDGGVINLILQELGGLHVRRHKDGQWFAVEPIPGALVCINGMILKVISNGK LESGIHRVATNSVSDRISLGCLTSPACSGECIIEPAKALLSE | |||
Physicochemical properties | |||
Number of amino acids: | 162 | ||
Molecular weight: | 17,600.139 | ||
Theoretical pI: | 6.080 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11835 | ||
Instability index: | 44.659 | ||
aromaticity | 0.043 | ||
GRAVY | -0.060 | ||
Secondary Structure Fraction | |||
Helix | 0.302 | ||
turn | 0.272 | ||
sheet | 0.278 |