Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319479.1 | 3prime_partial | 161 | 48-530(+) |
Amino Acid sequence : | |||
MDSGDNEVTIDLSPLLRVFKDGHVERMFGSPIVPPSLEDPTTGVASKDIDISPDIRARVYLPKLTNTTNEKLPTLVYYHGGGFCLESAFSFLDHRYLNLIVSEAKVIAISVEYRLAPEHP LPIAYEDSWTALQWVVSHVLENPGFEKEPWLVNHGNFEKVL | |||
Physicochemical properties | |||
Number of amino acids: | 161 | ||
Molecular weight: | 18,105.357 | ||
Theoretical pI: | 4.923 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25440 | ||
Instability index: | 28.049 | ||
aromaticity | 0.099 | ||
GRAVY | -0.124 | ||
Secondary Structure Fraction | |||
Helix | 0.360 | ||
turn | 0.255 | ||
sheet | 0.255 |