Acc_NO	ORF type	length	start-end position (strand +/-)
>GW319483.1	internal	153	459-1(-)
Amino Acid sequence :
KRVIWVAWLRNWKELSGKNNWEGLLNPLDLDLRKYIIQYGELAQATYDTFITETASKYAGASRYSMENLFTKVGLDPLKYRVTKFFYATASIPLPSGFLVRSLSREAWSKESNFMGYISV ATDEGKVALGRRDIVINWRGTMQNLEWVNDLQF
Physicochemical properties
Number of amino acids:		153
Molecular weight:		17,731.068
Theoretical pI:		9.300
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		50420 50420
Instability index:		22.826
aromaticity		0.144
GRAVY		-0.289
Secondary Structure Fraction
Helix		0.366
turn		0.222
sheet		0.261