Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319483.1 | internal | 153 | 459-1(-) |
Amino Acid sequence : | |||
KRVIWVAWLRNWKELSGKNNWEGLLNPLDLDLRKYIIQYGELAQATYDTFITETASKYAGASRYSMENLFTKVGLDPLKYRVTKFFYATASIPLPSGFLVRSLSREAWSKESNFMGYISV ATDEGKVALGRRDIVINWRGTMQNLEWVNDLQF | |||
Physicochemical properties | |||
Number of amino acids: | 153 | ||
Molecular weight: | 17,731.068 | ||
Theoretical pI: | 9.300 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 50420 50420 | ||
Instability index: | 22.826 | ||
aromaticity | 0.144 | ||
GRAVY | -0.289 | ||
Secondary Structure Fraction | |||
Helix | 0.366 | ||
turn | 0.222 | ||
sheet | 0.261 |