Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319486.1 | internal | 106 | 318-1(-) |
Amino Acid sequence : | |||
GAEEVILLDFWCSMYGMRPRIALAEKGVNYEYKEEDLKNKSSLLLQMNPIHEKIPVLIHNGKSICESLVILQYIDDVWKGNSPLLIPSDPYEKAQAWFWSDYMDNT | |||
Physicochemical properties | |||
Number of amino acids: | 106 | ||
Molecular weight: | 12,309.005 | ||
Theoretical pI: | 4.766 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30940 31065 | ||
Instability index: | 40.355 | ||
aromaticity | 0.113 | ||
GRAVY | -0.282 | ||
Secondary Structure Fraction | |||
Helix | 0.358 | ||
turn | 0.236 | ||
sheet | 0.283 |