Acc_NO	ORF type	length	start-end position (strand +/-)
>GW319486.1	internal	106	318-1(-)
Amino Acid sequence :
GAEEVILLDFWCSMYGMRPRIALAEKGVNYEYKEEDLKNKSSLLLQMNPIHEKIPVLIHNGKSICESLVILQYIDDVWKGNSPLLIPSDPYEKAQAWFWSDYMDNT
Physicochemical properties
Number of amino acids:		106
Molecular weight:		12,309.005
Theoretical pI:		4.766
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		30940 31065
Instability index:		40.355
aromaticity		0.113
GRAVY		-0.282
Secondary Structure Fraction
Helix		0.358
turn		0.236
sheet		0.283