Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319490.1 | internal | 132 | 397-2(-) |
Amino Acid sequence : | |||
HVLLIIADGQVTRSVDTVNGQLSPQEKRTVEAIVKASQYPLSIVLVGVGDGPWDMMREFDDNIPARAFDNFQFVNFTDIMSKNVDRSRKEAEFALSALMEIPSQYKATLELNILGARRGN ETDRIPLHPPRY | |||
Physicochemical properties | |||
Number of amino acids: | 132 | ||
Molecular weight: | 14,873.743 | ||
Theoretical pI: | 5.350 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
Instability index: | 34.813 | ||
aromaticity | 0.076 | ||
GRAVY | -0.299 | ||
Secondary Structure Fraction | |||
Helix | 0.311 | ||
turn | 0.227 | ||
sheet | 0.250 |