Acc_NO	ORF type	length	start-end position (strand +/-)
>GW319508.1	3prime_partial	195	68-652(+)
Amino Acid sequence :
MEVISNHNNGSTTKIILKNGSICNGNVNGNSHSNEKTENKLVECTNSIKPGWFSEFSALWPGEAFSLKIEKLLFQGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIVHLPL GSIPSPKKVLIIGGGIGFTLFEVSRYSTIEKIDIVEIDDVVIDVSRKYFPYLAAGFDDPRVTLIVGDGAAFVKAA
Physicochemical properties
Number of amino acids:		195
Molecular weight:		21,280.982
Theoretical pI:		5.209
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		19940 20065
Instability index:		23.966
aromaticity		0.097
GRAVY		-0.020
Secondary Structure Fraction
Helix		0.344
turn		0.282
sheet		0.210