Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319513.1 | internal | 117 | 353-3(-) |
Amino Acid sequence : | |||
RMKLGSNGLEVSAQGLGCMGMSAFYGPPKPEPDMIKLIHHAINSGVTFLDTSDIYGPHTNEILLSKTLKGGMRERIELATKFGISFADGKREVRGDPAYVRAACEASLKRLNVDCID | |||
Physicochemical properties | |||
Number of amino acids: | 117 | ||
Molecular weight: | 12,697.531 | ||
Theoretical pI: | 7.913 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
Instability index: | 28.057 | ||
aromaticity | 0.060 | ||
GRAVY | -0.207 | ||
Secondary Structure Fraction | |||
Helix | 0.265 | ||
turn | 0.265 | ||
sheet | 0.274 |