Acc_NO	ORF type	length	start-end position (strand +/-)
>GW319516.1	internal	193	1-579(+)
Amino Acid sequence :
DEENLIHNLPKDLRRDIKRHLCLALLMRVPMFEKMDEQLLDALCDRLKPVLYTEDSFIVREGDPVDEMLFVMRGKLLSVTTNGGRTGFFNSEYLKAGDFCGEELLTWALDPNSSTNLPIS TRTAQALSEVEAFALVADDLKFVASQFRRLHSKQLRHTFRFYSGQWRTWAACFLQAAWRNYCRKKVEESLREE
Physicochemical properties
Number of amino acids:		193
Molecular weight:		22,470.496
Theoretical pI:		6.155
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		27960 28210
Instability index:		42.175
aromaticity		0.104
GRAVY		-0.359
Secondary Structure Fraction
Helix		0.316
turn		0.166
sheet		0.321