Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319530.1 | internal | 113 | 340-2(-) |
Amino Acid sequence : | |||
PSPKKVLIIGGGIGSTLFEVSRYSTIEKIDIVEIDDVVIDVSRKYFPYLAAGFDDPRVTLIVGDGAAFVKAAQPGYYDAIIVDSSDPIGPAKDLFERPFFEAVAKALRPGGVV | |||
Physicochemical properties | |||
Number of amino acids: | 113 | ||
Molecular weight: | 12,103.744 | ||
Theoretical pI: | 4.682 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7450 | ||
Instability index: | 36.969 | ||
aromaticity | 0.106 | ||
GRAVY | 0.252 | ||
Secondary Structure Fraction | |||
Helix | 0.381 | ||
turn | 0.239 | ||
sheet | 0.195 |