Acc_NO	ORF type	length	start-end position (strand +/-)
>GW319536.1	internal	179	539-3(-)
Amino Acid sequence :
ILCSSRENRAKFWYAADYGMFHFCIADTEHDWREGSEQYKFIEQCFASANRHKQPWLIFAAHRVLGYSSNDWYANQGSFEEPMGREHLQKLWQKYKVDMAFFGHVHNYERVCPIYQNQCV NKEKSHYSGVVNGTIHIVAGGGGSHLNKFASINTTWSVFKDYDYGFVKLTAFNQSSLLF
Physicochemical properties
Number of amino acids:		179
Molecular weight:		20,876.163
Theoretical pI:		7.829
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		49390 49640
Instability index:		38.009
aromaticity		0.173
GRAVY		-0.488
Secondary Structure Fraction
Helix		0.324
turn		0.229
sheet		0.196