Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319539.1 | internal | 160 | 481-2(-) |
Amino Acid sequence : | |||
LIRTNRSAAATSATMGRMHSRGKGISASALPYKRTPPSWLKIPAPDVEDNICKFAKKGLTPSQIGVILRDSHGIAQVKSVTGSKILRILKAHGLAPEIPEDLYHLIKKAVAIRKHLERNR KDKDSKFRLILVESRIHQLARYYKKTKKLPPVWKYESTTA | |||
Physicochemical properties | |||
Number of amino acids: | 160 | ||
Molecular weight: | 17,985.942 | ||
Theoretical pI: | 10.469 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18450 | ||
Instability index: | 45.223 | ||
aromaticity | 0.056 | ||
GRAVY | -0.466 | ||
Secondary Structure Fraction | |||
Helix | 0.281 | ||
turn | 0.213 | ||
sheet | 0.238 |