Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319544.1 | internal | 150 | 452-3(-) |
Amino Acid sequence : | |||
KTMASLVSSWAAQVNSVPERYVVPSQKRLNINVPIGKDIPVIDLSLPSQNIVDQIIKASQEYGLFQVINHGVSKELIGDVLKVCGEFFKLPIEELEKYTDEEEELSEFEPNLDQKPKLFI EKEYKPKKNGKSDKEVIFWKDTFAHCTCPG | |||
Physicochemical properties | |||
Number of amino acids: | 150 | ||
Molecular weight: | 12,870.115 | ||
Theoretical pI: | 9.891 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19480 | ||
Instability index: | 39.913 | ||
aromaticity | 0.212 | ||
GRAVY | 0.370 | ||
Secondary Structure Fraction | |||
Helix | 0.500 | ||
turn | 0.144 | ||
sheet | 0.250 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319544.1 | 5prime_partial | 104 | 3-317(+) |
Amino Acid sequence : | |||
ARAGTMRKCIFPENYFFITLAILLRFIFFFNEKFWFLVQIWLKFTQLFFFISILLQFLNWQLEKLPTNFQNITNQLFRDSMVNHLKESILLRSFDDLINYILRR* | |||
Physicochemical properties | |||
Number of amino acids: | 104 | ||
Molecular weight: | 12,870.115 | ||
Theoretical pI: | 9.891 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19480 | ||
Instability index: | 39.913 | ||
aromaticity | 0.212 | ||
GRAVY | 0.370 | ||
Secondary Structure Fraction | |||
Helix | 0.500 | ||
turn | 0.144 | ||
sheet | 0.250 |