Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319547.1 | internal | 152 | 458-3(-) |
Amino Acid sequence : | |||
YIKEENMGVKGKLIASVEVKCGGHSIHDIFHMNTHHITKISPNKVQHFEVHEGETIKVGSIVGWKYSDDGKDKTCKQVIEAVDLEKKSITWKVIGGDLLELYNSFTIITSCDDHWTTWTL LYEKKTEDTPEPLVFLGYALHVTKEVEDHLVK | |||
Physicochemical properties | |||
Number of amino acids: | 152 | ||
Molecular weight: | 17,335.599 | ||
Theoretical pI: | 5.908 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29450 29575 | ||
Instability index: | 19.937 | ||
aromaticity | 0.086 | ||
GRAVY | -0.362 | ||
Secondary Structure Fraction | |||
Helix | 0.336 | ||
turn | 0.171 | ||
sheet | 0.197 |