Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319548.1 | 5prime_partial | 132 | 405-7(-) |
Amino Acid sequence : | |||
DGSRQYRNLFDAMLDSVYAAMDRSGGGSVGIVVSESGWPSAGAFGATTDNAATYLRNLIQHVKVGSPRKPGPIETYIFAMFDENNKNPELEKHFGLFSPNKQPKYNLNFGVSDSAWDISA ETNVTTSLISEM* | |||
Physicochemical properties | |||
Number of amino acids: | 132 | ||
Molecular weight: | 14,385.796 | ||
Theoretical pI: | 5.039 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18450 | ||
Instability index: | 40.082 | ||
aromaticity | 0.106 | ||
GRAVY | -0.399 | ||
Secondary Structure Fraction | |||
Helix | 0.273 | ||
turn | 0.326 | ||
sheet | 0.227 |