Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319549.1 | internal | 178 | 535-2(-) |
Amino Acid sequence : | |||
SARCNIQGLVSDLIKCGKQKGIMVEDPFDVFEESPQVRRAPPLVRVEKMFEQVQSKLPGAPKFLLCLLPERKNCDVYGPWKRKNLAEYGIVTQCIAPTRVNDQYITNVLLKINAKLGGLN SMLTVELSPSIPMVSKVPTIILGMDVSHGSPGQSDVPSIAAVVSSRQWPSISRYRASV | |||
Physicochemical properties | |||
Number of amino acids: | 178 | ||
Molecular weight: | 19,592.715 | ||
Theoretical pI: | 9.299 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17210 | ||
Instability index: | 48.639 | ||
aromaticity | 0.056 | ||
GRAVY | -0.067 | ||
Secondary Structure Fraction | |||
Helix | 0.320 | ||
turn | 0.281 | ||
sheet | 0.213 |